5HT2A Receptor polyclonal, anti-human, rat
€384.00
In stock
SKU
ARP-10-P9599
Quantity: 100 µg
Background:
The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones. 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.
Description:
Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A (HTR2A) detection. Tested with WB in Human, Rat.
Synonyms:
5 HT 2 antibody, 5 HT 2A antibody, 5 HT2 receptor antibody, 5 HT2A antibody, 5 hydroxytryptamine receptor 2A antibody, 5-HT-2 antibody, 5-HT-2A antibody, 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody, 5-hydroxytryptamine 2A receptor antibody, 5-hydroxytryptamine receptor 2A antibody, 5HT2A_HUMAN antibody, HTR 2 antibody, HTR 2A antibody, HTR2 antibody, HTR2, formerly antibody, HTR2A antibody, serotonin 5-HT-2 receptor, formerly antibody, serotonin 5-HT-2A receptor antibody, Serotonin receptor 2A antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, rat
Applications: WB
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review