ABCA1 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9467
Quantity: 100 µg
Background:
ABCA1 (ATP-binding cassette, sub-family A (ABC1), member 1), also known as ABC1, the cholesterol efflux regulatory protein (CERP) is a protein which in humans is encoded by the ABCA1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes contain 2,261 amino acids. Dot blot analysis of 50 tissues revealed ubiquitous expression of ABCA1 mRNA, with highest expression in placenta, liver, lung, adrenal glands, and all fetal tissues examined, and lowest expression in kidney, pancreas, pituitary, mammary gland, and bone marrow. This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterolefflux pump in the cellular lipid removal pathway. Using human ABCA1 expressed in the membrane fraction of sf9 insect cells, Szakacs et al. found specific, Mg(2+)-dependent ATP binding and low basal ATPase activity. Addition of potential lipid substrates or lipid acceptors did not modify the ATPase activity or nucleotide occlusion by ABCA1. Szakacs et al. speculated that ABCA1 may be a regulatory protein or may require other protein partners for full activation.
Description:
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family A member 1 (ABCA1) detection. Tested with WB in Human, Mouse, Rat.
Synonyms:
ABC 1 antibody, ABC Transporter 1 antibody, ABC-1 antibody, ABC1 antibody, ABCA 1 antibody, ABCA1 antibody, ABCA1_HUMAN antibody, ATP binding Cassette 1 antibody, ATP binding cassette sub family A ABC1 member 1 antibody, ATP binding cassette sub family A member 1 antibody, ATP binding Cassette Transporter 1 antibody, ATP-binding cassette 1 antibody, ATP-binding cassette sub-family A member 1 antibody, ATP-binding cassette transporter 1 antibody, CERP antibody, Cholesterol efflux regulatory protein antibody, FLJ14958 antibody, HDLDT1 antibody, Membrane bound antibody, MGC164864 antibody, MGC165011 antibody, TD antibody, TGD antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA1 (2231-2261aa KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV), identical to the related mouse sequence.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review