ABCA4 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10138
Catalog Number: AC-ABO10138
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Retinal-specific ATP-binding cassette transporter
Protein Function:
In the visual cycle, acts as an inward-directed retinoid flipase, retinoid substrates imported by ABCA4 from the extracellular or intradiscal (rod) membrane surfaces to the cytoplasmic membrane surface are all-trans-retinaldehyde (ATR) and N-retinyl-phosphatidyl-ethanolamine (NR-PE). Once transported to the cytoplasmic surface, ATR is reduced to vitamin A by trans- retinol dehydrogenase (tRDH) and then transferred to the retinal pigment epithelium (RPE) where it is converted to 11-cis-retinal. May play a role in photoresponse, removing ATR/NR-PE from the extracellular photoreceptor surfaces during bleach recovery. .
Other Names: Retinal-specific ATP-binding cassette transporter, ATP-binding cassette sub-family A member 4, RIM ABC transporter, RIM protein, RmP, Stargardt disease protein, ABCA4, ABCR
Subcellular Localization: Membrane ; Multi-pass membrane protein . Localized to outer segment disk edges of rods and cones, with around one million copies/photoreceptor.
Tissue Specificity: Retinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells.
Gene ID: 24
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
Calculated MW: 255944
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
In the visual cycle, acts as an inward-directed retinoid flipase, retinoid substrates imported by ABCA4 from the extracellular or intradiscal (rod) membrane surfaces to the cytoplasmic membrane surface are all-trans-retinaldehyde (ATR) and N-retinyl-phosphatidyl-ethanolamine (NR-PE). Once transported to the cytoplasmic surface, ATR is reduced to vitamin A by trans- retinol dehydrogenase (tRDH) and then transferred to the retinal pigment epithelium (RPE) where it is converted to 11-cis-retinal. May play a role in photoresponse, removing ATR/NR-PE from the extracellular photoreceptor surfaces during bleach recovery. .
Other Names: Retinal-specific ATP-binding cassette transporter, ATP-binding cassette sub-family A member 4, RIM ABC transporter, RIM protein, RmP, Stargardt disease protein, ABCA4, ABCR
Subcellular Localization: Membrane ; Multi-pass membrane protein . Localized to outer segment disk edges of rods and cones, with around one million copies/photoreceptor.
Tissue Specificity: Retinal-specific. Seems to be exclusively found in the rims of rod photoreceptor cells.
Gene ID: 24
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
Calculated MW: 255944
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review