ABCB10 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12656
Catalog Number: AC-ABO12656
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human;Rat.Protein Name: ATP-binding cassette sub-family B member 10, mitochondrial
Protein Function:
May mediate critical mitochondrial transport functions related to heme biosynthesis. .
Other Names: ATP-binding cassette sub-family B member 10, mitochondrial, ATP-binding cassette transporter 10, ABC transporter 10 protein, Mitochondrial ATP-binding cassette 2, M-ABC2, ABCB10
Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity: Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymph node, trachea and adrenal gland, and low levels are found in lung, kidney, spleen, thymus and colon.
Gene ID: 23456
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
Calculated MW: 79148
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May mediate critical mitochondrial transport functions related to heme biosynthesis. .
Other Names: ATP-binding cassette sub-family B member 10, mitochondrial, ATP-binding cassette transporter 10, ABC transporter 10 protein, Mitochondrial ATP-binding cassette 2, M-ABC2, ABCB10
Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity: Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymph node, trachea and adrenal gland, and low levels are found in lung, kidney, spleen, thymus and colon.
Gene ID: 23456
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
Calculated MW: 79148
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review