ABCG8 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10190
Catalog Number: AC-ABO10190
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human;Mouse;Rat.Protein Name: ATP-binding cassette sub-family G member 8
Protein Function:
Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile.
Other Names: ATP-binding cassette sub-family G member 8, Sterolin-2, ABCG8
Subcellular Localization: Membrane ; Multi-pass membrane protein .
Tissue Specificity: Strongly expressed in the liver, lower levels in the small intestine and colon. Detectable in a wide variety of human tissues.
Gene ID: 64241
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.
Calculated MW: 75679
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile.
Other Names: ATP-binding cassette sub-family G member 8, Sterolin-2, ABCG8
Subcellular Localization: Membrane ; Multi-pass membrane protein .
Tissue Specificity: Strongly expressed in the liver, lower levels in the small intestine and colon. Detectable in a wide variety of human tissues.
Gene ID: 64241
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.
Calculated MW: 75679
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review