ABR Picoband polyclonal, anti-human, mouse, rat

ABR Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12657
Catalog Number: AC-ABO12657
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein(ABR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Active breakpoint cluster region-related protein

Protein Function:
GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them.

Other Names: Active breakpoint cluster region-related protein, ABR

Tissue Specificity: Highly enriched in the brain. Much weaker expression in heart, lung and muscle.

Gene ID: 29

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.

Calculated MW: 97598

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ABR Picoband polyclonal, anti-human, mouse, rat