ACAA2 Picoband polyclonal, anti-human, mouse, rat

ACAA2 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11640
Catalog Number: AC-ABO11640
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for 3-ketoacyl-CoA thiolase, mitochondrial(ACAA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: 3-ketoacyl-CoA thiolase, mitochondrial

Protein Function:
Abolishes BNIP3-mediated apoptosis and mitochondrial damage. .

Other Names: 3-ketoacyl-CoA thiolase, mitochondrial, 2.3.1.16, Acetyl-CoA acyltransferase, Beta-ketothiolase, Mitochondrial 3-oxoacyl-CoA thiolase, T1, ACAA2

Subcellular Localization: Mitochondrion . Colocalizes with BNIP3 in the mitochondria.

Gene ID: 10449

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Calculated MW: 41924

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ACAA2 Picoband polyclonal, anti-human, mouse, rat