ACCN1 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO11664
Catalog Number: AC-ABO11664
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Acid-sensing ion channel 2(ASIC2) detection. Tested with WB in Human;Rat.Protein Name: Acid-sensing ion channel 2
Protein Function:
Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.
Other Names: Acid-sensing ion channel 2, ASIC2, Amiloride-sensitive brain sodium channel, Amiloride-sensitive cation channel 1, neuronal, Amiloride-sensitive cation channel neuronal 1, Brain sodium channel 1, BNC1, BNaC1, Mammalian degenerin homolog, ASIC2, ACCN, ACCN1, BNAC1, MDEG
Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes. .
Tissue Specificity: Brain and spinal cord. Isoform 1 is also detected in testis, liver, colon and ovary. .
Gene ID: 40
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 57709
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate.
Other Names: Acid-sensing ion channel 2, ASIC2, Amiloride-sensitive brain sodium channel, Amiloride-sensitive cation channel 1, neuronal, Amiloride-sensitive cation channel neuronal 1, Brain sodium channel 1, BNC1, BNaC1, Mammalian degenerin homolog, ASIC2, ACCN, ACCN1, BNAC1, MDEG
Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes. .
Tissue Specificity: Brain and spinal cord. Isoform 1 is also detected in testis, liver, colon and ovary. .
Gene ID: 40
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid.
Calculated MW: 57709
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review