Ace Picoband polyclonal, anti-mouse, rat

Ace Picoband polyclonal, anti-mouse, rat

€455.00
In stock
SKU
AC-ABO12817
Catalog Number: AC-ABO12817
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Ace detection. Tested with WB in Mouse;Rat.

Protein Function:
Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. This GPIase activity seems to be crucial for the egg-binding ability of the sperm.

Other Names: Angiotensin-converting enzyme, ACE, 3.2.1.-, 3.4.15.1, Dipeptidyl carboxypeptidase I, Kininase II, CD143, Angiotensin-converting enzyme, soluble form, Ace, Dcp1

Subcellular Localization: Angiotensin-converting enzyme, soluble form: Secreted.

Tissue Specificity: Testis-specific isoform is expressed in spermatocytes, adult testis.

Gene ID: 11421

Immunogen: A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).

Calculated MW: 150918

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Storage: At -20˚C; for one year. After reconstitution, at 4˚C; for one month. It can also be aliquotted and stored frozen at -20˚C; for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Ace Picoband polyclonal, anti-mouse, rat