Aconitase 2 Picoband polyclonal, anti-human, mouse, rat

Aconitase 2 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12658
Catalog Number: AC-ABO12658
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Aconitate hydratase, mitochondrial

Protein Function:
Catalyzes the isomerization of citrate to isocitrate via cis-aconitate. .

Other Names: Aconitate hydratase, mitochondrial, Aconitase, 4.2.1.3, Citrate hydro-lyase, ACO2

Subcellular Localization: Mitochondrion .

Gene ID: 50

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.

Calculated MW: 85425

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Aconitase 2 Picoband polyclonal, anti-human, mouse, rat