Aconitase 2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12658
Catalog Number: AC-ABO12658
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aconitate hydratase, mitochondrial(ACO2) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Aconitate hydratase, mitochondrial
Protein Function:
Catalyzes the isomerization of citrate to isocitrate via cis-aconitate. .
Other Names: Aconitate hydratase, mitochondrial, Aconitase, 4.2.1.3, Citrate hydro-lyase, ACO2
Subcellular Localization: Mitochondrion .
Gene ID: 50
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
Calculated MW: 85425
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Catalyzes the isomerization of citrate to isocitrate via cis-aconitate. .
Other Names: Aconitate hydratase, mitochondrial, Aconitase, 4.2.1.3, Citrate hydro-lyase, ACO2
Subcellular Localization: Mitochondrion .
Gene ID: 50
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aconitase 2 (561-596aa TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH), identical to the related mouse and rat sequences.
Calculated MW: 85425
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review