ACSL5 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10317
Catalog Number: AC-ABO10317
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Long-chain-fatty-acid--CoA ligase 5(ACSL5) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Long-chain-fatty-acid--CoA ligase 5
Protein Function:
Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. .
Other Names: Long-chain-fatty-acid--CoA ligase 5, 6.2.1.3, Long-chain acyl-CoA synthetase 5, LACS 5, ACSL5, ACS5, FACL5
Subcellular Localization: Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane ; Single-pass type III membrane protein . Endoplasmic reticulum membrane ; Single-pass type III membrane protein .
Gene ID: 51703
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.
Calculated MW: 75991
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. .
Other Names: Long-chain-fatty-acid--CoA ligase 5, 6.2.1.3, Long-chain acyl-CoA synthetase 5, LACS 5, ACSL5, ACS5, FACL5
Subcellular Localization: Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane ; Single-pass type III membrane protein . Endoplasmic reticulum membrane ; Single-pass type III membrane protein .
Gene ID: 51703
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA), different from the related mouse and rat sequences by six amino acids.
Calculated MW: 75991
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review