ACTH Picoband polyclonal, anti-human, mouse, rat

ACTH Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11762
Catalog Number: AC-ABO11762
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human;Mouse;Rat.Protein Name: Pro-opiomelanocortin

Protein Function:
ACTH stimulates the adrenal glands to release cortisol.

Other Names: Pro-opiomelanocortin, POMC, Corticotropin-lipotropin, NPP, Melanotropin gamma, Gamma-MSH, Potential peptide, Corticotropin, Adrenocorticotropic hormone, ACTH, Melanotropin alpha, Alpha-MSH, Corticotropin-like intermediary peptide, CLIP, Lipotropin beta, Beta-LPH, Lipotropin gamma, Gamma-LPH, Melanotropin beta, Beta-MSH, Beta-endorphin, Met-enkephalin, POMC

Subcellular Localization: Secreted.

Tissue Specificity: ACTH and MSH are produced by the pituitary gland.

Gene ID: 5443

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Calculated MW: 29424

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ACTH Picoband polyclonal, anti-human, mouse, rat