ACTH polyclonal, anti-human, mouse, rat

ACTH polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9039
Catalog Number: 10-P9039
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

Description:
Rabbit IgG polyclonal antibody for Pro-opiomelanocortin (POMC) detection. Tested with IHC-P in Human, Mouse, Rat.

Synonyms:
ACTH antibody, Adrenocorticotropic hormone antibody, Adrenocorticotropin antibody, Adrenocorticotropin Hormone antibody, Alpha Melanocyte Stimulating Hormone antibody, alpha-MSH antibody, alphaMSH antibody, Beta Endorphin antibody, Beta Lipotropin antibody, Beta LPH antibody, Beta Melanocyte Stimulating Hormone antibody, Beta-endorphin antibody, beta-MSH antibody, CLIP antibody, Corticotropin antibody, Corticotropin Like Intermediary Peptide antibody, Corticotropin lipotropin antibody, Corticotropin lipotropin precursor antibody, Corticotropin-like intermediary peptide antibody, Gamma LPH antibody, gamma-MSH antibody, Lipotropin Beta antibody, Lipotropin Gamma antibody, Lipotropin, included antibody, LPH antibody, Melanocyte-stimulating hormone, included antibody, Melanotropin Alpha antibody, Melanotropin beta antibody, Melanotropin gamma antibody, Melanotropin, included antibody, Met Enkephalin antibody, Met-enkephalin antibody, MSH antibody, NPP antibody, Opiomelanocortin prepropeptide antibody, POC antibody, POMC antibody, Pomc-1 antibody, Pomc1 antibody, Pomc2 antibody, Pro ACTH endorphin antibody, Pro opiomelanocortin antibody, Pro-opiomelanocortin-alpha antibody, Proopiomelanocortin antibody, Proopiomelanocortin preproprotein antibody, Tetracosactide antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ACTH polyclonal, anti-human, mouse, rat