ACTN3 Picoband polyclonal, anti-human, mouse, rat

ACTN3 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11644
Catalog Number: AC-ABO11644
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Alpha-actinin-3

Protein Function:
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.

Other Names: Alpha-actinin-3, Alpha-actinin skeletal muscle isoform 3, F-actin cross-linking protein, ACTN3

Tissue Specificity: Expressed only in a subset of type 2 skeletal muscle fibers. .

Gene ID: 89

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.

Calculated MW: 103241

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ACTN3 Picoband polyclonal, anti-human, mouse, rat