ACTN3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11644
Catalog Number: AC-ABO11644
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Alpha-actinin-3
Protein Function:
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Other Names: Alpha-actinin-3, Alpha-actinin skeletal muscle isoform 3, F-actin cross-linking protein, ACTN3
Tissue Specificity: Expressed only in a subset of type 2 skeletal muscle fibers. .
Gene ID: 89
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Calculated MW: 103241
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Other Names: Alpha-actinin-3, Alpha-actinin skeletal muscle isoform 3, F-actin cross-linking protein, ACTN3
Tissue Specificity: Expressed only in a subset of type 2 skeletal muscle fibers. .
Gene ID: 89
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Calculated MW: 103241
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review