ADAM2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10339
Catalog Number: AC-ABO10339
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Disintegrin and metalloproteinase domain-containing protein 2
Protein Function:
Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein.
Other Names: Disintegrin and metalloproteinase domain-containing protein 2, ADAM 2, Cancer/testis antigen 15, CT15, Fertilin subunit beta, PH-30, PH30, PH30-beta, ADAM2, FTNB
Subcellular Localization: Membrane; Single-pass type I membrane protein.
Tissue Specificity: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Gene ID: 2515
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
Calculated MW: 82457
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein.
Other Names: Disintegrin and metalloproteinase domain-containing protein 2, ADAM 2, Cancer/testis antigen 15, CT15, Fertilin subunit beta, PH-30, PH30, PH30-beta, ADAM2, FTNB
Subcellular Localization: Membrane; Single-pass type I membrane protein.
Tissue Specificity: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Gene ID: 2515
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
Calculated MW: 82457
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review