ADAM2 Picoband polyclonal, anti-human, mouse, rat

ADAM2 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10339
Catalog Number: AC-ABO10339
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Function:
Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein.

Other Names: Disintegrin and metalloproteinase domain-containing protein 2, ADAM 2, Cancer/testis antigen 15, CT15, Fertilin subunit beta, PH-30, PH30, PH30-beta, ADAM2, FTNB

Subcellular Localization: Membrane; Single-pass type I membrane protein.

Tissue Specificity: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.

Gene ID: 2515

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.

Calculated MW: 82457

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ADAM2 Picoband polyclonal, anti-human, mouse, rat