ADAM28 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO10330
Catalog Number: AC-ABO10330
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.Protein Name: Disintegrin and metalloproteinase domain-containing protein 28
Protein Function:
May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation.
Other Names: Disintegrin and metalloproteinase domain-containing protein 28, ADAM 28, 3.4.24.-, Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II, eMDC II, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, MDC-L, ADAM28, ADAM23, MDCL
Subcellular Localization: Isoform 1: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity: Expressed predominantly in secondary lymphoid tissues, such as lymph node, spleen, small intestine, stomach, colon, appendix and trachea. The lymphocyte population is responsible for expression of this protein in these tissues. Isoform 2 is expressed preferentially in spleen.
Gene ID: 10863
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
Calculated MW: 87148
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation.
Other Names: Disintegrin and metalloproteinase domain-containing protein 28, ADAM 28, 3.4.24.-, Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II, eMDC II, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L, MDC-L, ADAM28, ADAM23, MDCL
Subcellular Localization: Isoform 1: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity: Expressed predominantly in secondary lymphoid tissues, such as lymph node, spleen, small intestine, stomach, colon, appendix and trachea. The lymphocyte population is responsible for expression of this protein in these tissues. Isoform 2 is expressed preferentially in spleen.
Gene ID: 10863
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
Calculated MW: 87148
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review