ADAMTS1 Picoband polyclonal, anti-human, mouse, rat antibody
€270.00
In stock
SKU
AC-ABO10275
Description: Rabbit IgG polyclonal antibody for B2 bradykinin receptor (BDKRB2) detection. Tested with WB in human.
Protein Name: B2 bradykinin receptor
Background:
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Other Names:
B2 bradykinin receptor, B2R, BK-2 receptor, BDKRB2, BKR2
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Ubiquitous. Widespread in normal smooth muscle tissue and neurons. .
Gene ID: 624
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 44461
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: B2 bradykinin receptor
Background:
Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Other Names:
B2 bradykinin receptor, B2R, BK-2 receptor, BDKRB2, BKR2
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: Ubiquitous. Widespread in normal smooth muscle tissue and neurons. .
Gene ID: 624
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
Calculated MW: 44461
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review