Adenylate Kinase 1 Picoband polyclonal, anti-human, mouse, rat

Adenylate Kinase 1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11651
Catalog Number: AC-ABO11651
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Adenylate kinase isoenzyme 1

Protein Function:
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. .

Other Names: Adenylate kinase isoenzyme 1 {ECO:0000255|HAMAP-Rule:MF_03171}, AK 1 {ECO:0000255|HAMAP-Rule:MF_03171}, 2.7.4.3 {ECO:0000255|HAMAP-Rule:MF_03171}, 2.7.4.6 {ECO:0000255|HAMAP-Rule:MF_03171}, ATP-AMP transphosphorylase 1 {ECO:0000255|HAMAP-Rule:MF_03171}, ATP:AMP phosphotransferase {ECO:0000255|HAMAP-Rule:MF_03171}, Adenylate monophosphate kinase {ECO:0000255|HAMAP-Rule:MF_03171}, Myokinase {ECO:0000255|HAMAP-Rule:MF_03171}, AK1 {ECO:0000255|HAMAP-Rule:MF_03171}

Subcellular Localization: Cytoplasm.

Gene ID: 203

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

Calculated MW: 21635

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Adenylate Kinase 1 Picoband polyclonal, anti-human, mouse, rat