Adenylosuccinate Lyase Picoband polyclonal, anti-human, mouse, rat

Adenylosuccinate Lyase Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12877
Catalog Number: AC-ABO12877
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Adenylosuccinate Lyase detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Other Names: Argininosuccinate lyase, ASAL, 4.3.2.1, Arginosuccinase, ASL

Gene ID: 435

Immunogen: A synthetic peptide corresponding to a sequence of human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN).

Calculated MW: 51658

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Adenylosuccinate Lyase Picoband polyclonal, anti-human, mouse, rat