ADRA1A polyclonal, anti-human, mouse, rat

ADRA1A polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9752
Catalog Number: 10-P9752
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.

Description:
Rabbit IgG polyclonal antibody for Alpha-1A adrenergic receptor (ADRA1A) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
ADA1D_HUMAN antibody, Adra1 antibody, Adra1a antibody, Adra1d antibody, ADRA1R antibody, Adrd1 antibody, Adrenergic alpha1A receptor antibody, Adrenergic alpha1D receptor antibody, Adrenergic receptor alpha 1d antibody, Adrenergic receptor delta1 antibody, Adrenoceptor alpha 1D antibody, Alpha 1D adrenoceptor antibody, Alpha 1D adrenoreceptor antibody, Alpha adrenergic receptor 1a antibody, Alpha-1A adrenergic receptor antibody, Alpha-1D adrenergic receptor antibody, Alpha-1D adrenoceptor antibody, Alpha-1D adrenoreceptor antibody, Alpha-adrenergic receptor 1a antibody, ALPHA1 antibody, Alpha1A adrenergic receptor antibody, Alpha1D adrenergic receptor antibody, Alpha1DAR antibody, DAR antibody, dJ779E11.2 antibody, Gpcr8 antibody, RA42 antibody, Spr8 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ADRA1A polyclonal, anti-human, mouse, rat