AGTR2 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
AGTR2 is also known as angiotensin II receptor, type 2. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5' untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.

Description:
Rabbit IgG polyclonal antibody for Type-2 angiotensin II receptor (AGTR2) detection. Tested with WB in Human, Rat.

Synonyms:
AGTR 2 antibody, Agtr2 antibody, AGTR2_HUMAN antibody, angiotensin II receptor type 2 antibody, Angiotensin II type-2 receptor antibody, Angiotensin receptor 2 antibody, AT 2 antibody, AT2 antibody, ATGR 2 antibody, ATGR2 antibody, MRX 88 antibody, MRX88 antibody, Type 2 angiotensin II receptor antibody, Type-2 angiotensin II receptor antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.