AHSG polyclonal, anti-human, rat
€384.00
In stock
SKU
ARP-10-P9568
Quantity: 100 µg
Background:
Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.
Description:
Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein (AHSG) detection. Tested with WB, IHC-P, ELISA in Human, Rat.
Synonyms:
59 kDa bone sialic acid-containing protein antibody, A2HS antibody, Aa2-066 antibody, AHS antibody, Ahsg alpha-2-HS-glycoprotein antibody, Ahsg antibody, Alpha 2 HS Glycoprotein antibody, Alpha 2 Z globulin antibody, Alpha-2-HS-glycoprotein antibody, Alpha-2-HS-glycoprotein chain B antibody, Alpha-2-Z-globulin antibody, Asialofetuin antibody, Ba alpha 2 glycoprotein antibody, Ba-alpha-2-glycoprotein antibody, BSP antibody, Countertrypin antibody, Fetua antibody, FETUA_HUMAN antibody, Fetuin, mouse, homolog of antibody, Fetuin A antibody, Fetuin-A antibody, Glycoprotein PP63 antibody, HSGA antibody, pp63 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, rat
Applications: WB, IHC-P, ELISA
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review