AIF polyclonal, anti-human, mouse, rat

AIF polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9366
Catalog Number: 10-P9366
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

Description:
Rabbit IgG polyclonal antibody for Apoptosis-inducing factor 1, mitochondrial (AIFM1) detection. Tested with WB, IHC-P, ICC in Human, Mouse, Rat.

Synonyms:
AIFM1 antibody, AIFM1_HUMAN antibody, Apoptosis inducing factor 1, mitochondrial antibody, Apoptosis inducing factor antibody, Apoptosis inducing factor, mitochondrion associated, 1 antibody, Apoptosis-inducing factor 1 antibody, CMTX4 antibody, COXPD6 antibody, Harlequin antibody, Hq antibody, mAIF antibody, MGC111425 antibody, MGC5706 antibody, mitochondrial antibody, Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody, neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody, PDCD 8 antibody, PDCD8 antibody, Programmed cell death 8 (apoptosis inducing factor) antibody, Programmed cell death 8 antibody, Programmed cell death 8 isoform 1 antibody, Programmed cell death 8 isoform 2 antibody, Programmed cell death 8 isoform 3 antibody, Programmed cell death protein 8 antibody, Programmed cell death protein 8 mitochondrial antibody, Programmed cell death protein 8 mitochondrial precursor antibody, Striatal apoptosis inducing factor antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P, ICC

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:AIF polyclonal, anti-human, mouse, rat