AKR1B10 Picoband polyclonal, anti-human

AKR1B10 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO10273
Catalog Number: AC-ABO10273
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human.Protein Name: Aldo-keto reductase family 1 member B10

Protein Function:
Acts as all-trans-retinaldehyde reductase. Can efficiently reduce aliphatic and aromatic aldehydes, and is less active on hexoses (in vitro). May be responsible for detoxification of reactive aldehydes in the digested food before the nutrients are passed on to other organs. .

Other Names: Aldo-keto reductase family 1 member B10, 1.1.1.-, ARL-1, Aldose reductase-like, Aldose reductase-related protein, ARP, hARP, Small intestine reductase, SI reductase, AKR1B10, AKR1B11

Subcellular Localization: Lysosome . Secreted . Secreted through a lysosome-mediated non-classical pathway.

Tissue Specificity: Found in many tissues. Highly expressed in small intestine, colon and adrenal gland.

Gene ID: 57016

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).

Calculated MW: 36020

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:AKR1B10 Picoband polyclonal, anti-human