ALDH1B1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11655
Catalog Number: AC-ABO11655
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Aldehyde dehydrogenase X, mitochondrial
Protein Function:
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Other Names: Aldehyde dehydrogenase X, mitochondrial, 1.2.1.3, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH1B1, ALDH5, ALDHX
Subcellular Localization: Mitochondrion matrix.
Tissue Specificity: Liver, testis and to a lesser extent in brain.
Gene ID: 219
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Calculated MW: 57249
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.
Other Names: Aldehyde dehydrogenase X, mitochondrial, 1.2.1.3, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH1B1, ALDH5, ALDHX
Subcellular Localization: Mitochondrion matrix.
Tissue Specificity: Liver, testis and to a lesser extent in brain.
Gene ID: 219
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Calculated MW: 57249
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review