ALDH1B1 Picoband polyclonal, anti-human, mouse, rat

ALDH1B1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11655
Catalog Number: AC-ABO11655
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase X, mitochondrial(ALDH1B1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Aldehyde dehydrogenase X, mitochondrial

Protein Function:
ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.

Other Names: Aldehyde dehydrogenase X, mitochondrial, 1.2.1.3, Aldehyde dehydrogenase 5, Aldehyde dehydrogenase family 1 member B1, ALDH1B1, ALDH5, ALDHX

Subcellular Localization: Mitochondrion matrix.

Tissue Specificity: Liver, testis and to a lesser extent in brain.

Gene ID: 219

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Calculated MW: 57249

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ALDH1B1 Picoband polyclonal, anti-human, mouse, rat