ALDH2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12160
Catalog Number: AC-ABO12160
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial (ALDH2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Aldehyde dehydrogenase, mitochondrial
Other Names: Aldehyde dehydrogenase, mitochondrial, 1.2.1.3, ALDH class 2, ALDH-E2, ALDHI, ALDH2, ALDM
Subcellular Localization: Mitochondrion matrix.
Gene ID: 217
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Calculated MW: 56381
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Other Names: Aldehyde dehydrogenase, mitochondrial, 1.2.1.3, ALDH class 2, ALDH-E2, ALDHI, ALDH2, ALDM
Subcellular Localization: Mitochondrion matrix.
Gene ID: 217
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Calculated MW: 56381
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review