ALDH2 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9472
Quantity: 100 µg
Background:
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Description:
Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial (ALDH2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
Acetaldehyde dehydrogenase 2 antibody, Aldehyde dehydrogenase 2 family (mitochondrial) antibody, Aldehyde dehydrogenase 2 family antibody, Aldehyde dehydrogenase mitochondrial antibody, Aldehyde dehydrogenase, mitochondrial antibody, ALDH 2 antibody, ALDH class 2 antibody, ALDH E2 antibody, ALDH-E2 antibody, Aldh2 antibody, ALDH2_HUMAN antibody, ALDHI antibody, ALDM antibody, Liver mitochondrial ALDH antibody, MGC1806 antibody, Mitochondrial aldehyde dehydrogenase 2 antibody, MS767 antibody, Nucleus encoded mitochondrial aldehyde dehydrogenase 2 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review