ALDH7A1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11656
Catalog Number: AC-ABO11656
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-aminoadipic semialdehyde dehydrogenase(ALDH7A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase
Protein Function:
Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. .
Other Names: Alpha-aminoadipic semialdehyde dehydrogenase, Alpha-AASA dehydrogenase, 1.2.1.31, Aldehyde dehydrogenase family 7 member A1, 1.2.1.3, Antiquitin-1, Betaine aldehyde dehydrogenase, 1.2.1.8, Delta1-piperideine-6-carboxylate dehydrogenase, P6c dehydrogenase, ALDH7A1, ATQ1
Subcellular Localization: Cytoplasm, cytosol . Nucleus .
Tissue Specificity: Abundant in hepatoma cells and fetal cochlea, ovary, eye, heart, adrenal gland, liver and kidney. Low levels present in adult peripheral blood leukocytes and fetal brain, thymus, spleen, skeletal muscle, lung and tongue. .
Gene ID: 501
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 58487
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. .
Other Names: Alpha-aminoadipic semialdehyde dehydrogenase, Alpha-AASA dehydrogenase, 1.2.1.31, Aldehyde dehydrogenase family 7 member A1, 1.2.1.3, Antiquitin-1, Betaine aldehyde dehydrogenase, 1.2.1.8, Delta1-piperideine-6-carboxylate dehydrogenase, P6c dehydrogenase, ALDH7A1, ATQ1
Subcellular Localization: Cytoplasm, cytosol . Nucleus .
Tissue Specificity: Abundant in hepatoma cells and fetal cochlea, ovary, eye, heart, adrenal gland, liver and kidney. Low levels present in adult peripheral blood leukocytes and fetal brain, thymus, spleen, skeletal muscle, lung and tongue. .
Gene ID: 501
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
Calculated MW: 58487
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review