Alpha Amylase 1 Picoband polyclonal, anti-human, mouse, rat

Alpha Amylase 1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10349
Catalog Number: AC-ABO10349
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-amylase 1(AMY1A|AMY1B|AMY1C) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Alpha-amylase 1

Other Names: Alpha-amylase 1, 3.2.1.1, 1,4-alpha-D-glucan glucanohydrolase 1, Salivary alpha-amylase, AMY1A, AMY1

Subcellular Localization: Secreted.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Calculated MW: 57768 MW

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Alpha Amylase 1 Picoband polyclonal, anti-human, mouse, rat