Alpha Defensin 1 Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO10346
Catalog Number: AC-ABO10346
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human;Rat.Protein Name: Neutrophil defensin 1
Protein Function:
Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram- negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. .
Other Names: Neutrophil defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, HP 1-56, Neutrophil defensin 2, HNP-2, HP-2, HP2, DEFA1, DEF1, DEFA2, MRS
Subcellular Localization: Secreted.
Gene ID: 1667;728358
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
Calculated MW: 10201
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram- negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. .
Other Names: Neutrophil defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, HP 1-56, Neutrophil defensin 2, HNP-2, HP-2, HP2, DEFA1, DEF1, DEFA2, MRS
Subcellular Localization: Secreted.
Gene ID: 1667;728358
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
Calculated MW: 10201
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review