Alpha Defensin 1 Picoband polyclonal, anti-human, rat

Alpha Defensin 1 Picoband polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO10346
Catalog Number: AC-ABO10346
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Neutrophil defensin 1(DEFA1) detection. Tested with WB in Human;Rat.Protein Name: Neutrophil defensin 1

Protein Function:
Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram- negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. .

Other Names: Neutrophil defensin 1, Defensin, alpha 1, HNP-1, HP-1, HP1, HP 1-56, Neutrophil defensin 2, HNP-2, HP-2, HP2, DEFA1, DEF1, DEFA2, MRS

Subcellular Localization: Secreted.

Gene ID: 1667;728358

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).

Calculated MW: 10201

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Alpha Defensin 1 Picoband polyclonal, anti-human, rat