AMACR Picoband polyclonal, anti-human, rat
€455.00
In stock
SKU
AC-ABO12668
Catalog Number: AC-ABO12668
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Alpha-methylacyl-CoA racemase(AMACR) detection. Tested with WB in Human;Rat.Protein Name: Alpha-methylacyl-CoA racemase
Protein Function:
Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers.
Other Names: Alpha-methylacyl-CoA racemase, 5.1.99.4, 2-methylacyl-CoA racemase, AMACR
Subcellular Localization: Peroxisome . Mitochondrion .
Gene ID: 23600
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.
Calculated MW: 42387
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers.
Other Names: Alpha-methylacyl-CoA racemase, 5.1.99.4, 2-methylacyl-CoA racemase, AMACR
Subcellular Localization: Peroxisome . Mitochondrion .
Gene ID: 23600
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids.
Calculated MW: 42387
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review