AMPK beta 1 polyclonal, anti-human

AMPK beta 1 polyclonal, anti-human

€384.00
In stock
SKU
ARP-10-P9738
Catalog Number: 10-P9738
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
5'-AMP-activated protein kinase subunit beta-1 is an enzyme that in humans is encoded by the PRKAB1 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.

Description:
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1 (PRKAB1) detection. Tested with WB in Human.

Synonyms:
1300015D22Rik antibody, 5''-AMP-activated protein kinase subunit beta-1 antibody, AAKB1_HUMAN antibody, AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1 antibody, AMP-activated, noncatalytic, beta-1 antibody, AMPK antibody, AMPK beta 1 chain antibody, AMPK subunit beta-1 antibody, AMPK-BETA-1 antibody, AMPKb antibody, AU021155 antibody, E430008F22 antibody, HAMPKb antibody, MGC17785 antibody, PRKAB1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:AMPK beta 1 polyclonal, anti-human