AMPK beta 2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
5' AMP activated protein kinase beta 2 subunit antibody, 5' AMP activated protein kinase subunit beta 2 antibody, 5''-AMP-activated protein kinase subunit beta-2 antibody, AAKB2_HUMAN antibody, AMP activated protein kinase beta 2 non catalytic subunit antibody, AMPK beta 2 antibody, AMPK beta 2 chain antibody, AMPK subunit beta 2 antibody, AMPK subunit beta-2 antibody, MGC61468 antibody, PRKAB 2 antibody, Prkab2 antibody, Protein kinase AMP activated beta 2 non catalytic subunit antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.