ANGPTL2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10322
Catalog Number: AC-ABO10322
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 2(ANGPTL2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Angiopoietin-related protein 2
Protein Function:
Induces sprouting in endothelial cells through an autocrine and paracrine action.
Other Names: Angiopoietin-related protein 2, Angiopoietin-like protein 2, ANGPTL2, ARP2
Subcellular Localization: Secreted.
Tissue Specificity: Widely expressed in heart, small intestine, spleen and stomach. Also found in lower levels in colon, ovary, adrenal gland, skeletal muscle and in prostate.
Gene ID: 23452
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.
Calculated MW: 57104
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Induces sprouting in endothelial cells through an autocrine and paracrine action.
Other Names: Angiopoietin-related protein 2, Angiopoietin-like protein 2, ANGPTL2, ARP2
Subcellular Localization: Secreted.
Tissue Specificity: Widely expressed in heart, small intestine, spleen and stomach. Also found in lower levels in colon, ovary, adrenal gland, skeletal muscle and in prostate.
Gene ID: 23452
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ANGPTL2 (275-312aa WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD), different from the related mouse sequence by one amino acid.
Calculated MW: 57104
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review