APC2 Picoband polyclonal, anti-human

APC2 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO11659
Catalog Number: AC-ABO11659
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection. Tested with WB in Human.Protein Name: Adenomatous polyposis coli protein 2

Protein Function:
Promotes rapid degradation of CTNNB1 and may function as a tumor suppressor. May function in Wnt signaling. .

Other Names: Adenomatous polyposis coli protein 2, Adenomatous polyposis coli protein-like, APC-like, APC2, APCL

Subcellular Localization: Cytoplasm, cytoskeleton . Golgi apparatus . Cytoplasm . Cytoplasm, perinuclear region . Associated with actin filaments (PubMed:11691822). Associated with microtubule network (PubMed:10644998, PubMed:11691822). .

Tissue Specificity: Widely expressed (at protein level). Specifically expressed in the CNS. .

Gene ID: 10297

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.

Calculated MW: 243949

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:APC2 Picoband polyclonal, anti-human