APH1a polyclonal, anti-human, mouse

Quantity: 100 µg

Background:
APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

Description:
Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1 (APH1A) detection. Tested with WB in Human, Mouse.

Synonyms:
6530402N02Rik antibody, AL138795.3 antibody, Anterior Pharynx Defective 1 antibody, Anterior pharynx defective 1 homolog A antibody, APH 1A antibody, Aph 1alpha antibody, APH-1a antibody, Aph-1alpha antibody, Aph1a antibody, APH1A gamma secretase subunit antibody, APH1A_HUMAN antibody, CGI 78 antibody, CGI78 antibody, Gamma secretase subunit APH 1A antibody, Gamma Secretase Subunit APH1a antibody, Gamma-secretase subunit APH-1A antibody, Likely ortholog of C. elegans anterior pharynx defective 1A antibody, Presenilin Stabilization Factor antibody, Presenilin-stabilization factor antibody, PSF antibody, UNQ579/PRO1141 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.