APLP1 Picoband polyclonal, anti-human, mouse, rat

APLP1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12164
Catalog Number: AC-ABO12164
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Amyloid-like protein 1(APLP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Amyloid-like protein 1

Protein Function:
May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding (By similarity). Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I. .

Other Names: Amyloid-like protein 1, APLP, APLP-1, C30, APLP1

Subcellular Localization: Cell membrane; Single-pass type I membrane protein.

Tissue Specificity: Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). .

Gene ID: 333

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids.

Calculated MW: 72176

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:APLP1 Picoband polyclonal, anti-human, mouse, rat