APRT Picoband polyclonal, anti-human

APRT Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO10255
Catalog Number: AC-ABO10255
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.Protein Name: Adenine phosphoribosyltransferase

Protein Function:
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Other Names: Adenine phosphoribosyltransferase, APRT, 2.4.2.7, APRT

Subcellular Localization: Cytoplasm.

Gene ID: 353

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.

Calculated MW: 19608

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:APRT Picoband polyclonal, anti-human