Aquaporin 1 polyclonal, anti-human, mouse, rat

Aquaporin 1 polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9473
Catalog Number: 10-P9473
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Description:
Rabbit IgG polyclonal antibody for Aquaporin-1 (AQP1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
AQP 1 antibody, AQP CHIP antibody, AQP-1 antibody, AQP1 antibody, AQP1_HUMAN antibody, Aquaporin CHIP antibody, Aquaporin-1 antibody, Aquaporin-CHIP antibody, Aquaporin1 antibody, Channel forming integral protein 28kDa antibody, Channel like integral membrane protein 28 kDa antibody, CHIP 28 antibody, CHIP28 antibody, CO antibody, Colton blood group antibody, Growth factor induced delayed early response protein antibody, MGC26324 antibody, Urine water channel antibody, Water channel protein CHIP 29 antibody, Water channel protein CHIP29 antibody, Water channel protein for red blood cells and kidney proximal tubule antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Aquaporin 1 polyclonal, anti-human, mouse, rat