Aquaporin 2 Picoband polyclonal, anti-human, mouse, rat

Aquaporin 2 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12162
Catalog Number: AC-ABO12162
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Aquaporin-2(AQP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Aquaporin-2

Protein Function:
Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Other Names: Aquaporin-2, AQP-2, ADH water channel, Aquaporin-CD, AQP-CD, Collecting duct water channel protein, WCH-CD, Water channel protein for renal collecting duct, AQP2

Subcellular Localization: Apical cell membrane ; Multi-pass membrane protein . Basolateral cell membrane ; Multi-pass membrane protein . Cytoplasmic vesicle membrane ; Multi- pass membrane protein . Golgi apparatus, trans-Golgi network membrane ; Multi-pass membrane protein . Shuttles from vesicles to the apical membrane. Vasopressin-regulated phosphorylation is required for translocation to the apical cell membrane. PLEKHA8/FAPP2 is required to transport AQP2 from the TGN to sites where AQP2 is phosphorylated.

Tissue Specificity: Expressed in renal collecting tubules.

Gene ID: 359

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 28837

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Aquaporin 2 Picoband polyclonal, anti-human, mouse, rat