Arc Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12439
Catalog Number: AC-ABO12439
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Activity-regulated cytoskeleton-associated protein
Protein Function:
Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. .
Other Names: Activity-regulated cytoskeleton-associated protein, ARC/ARG3.1, Activity-regulated gene 3.1 protein homolog, Arg3.1, ARC {ECO:0000312|EMBL:AAG33705.1}
Subcellular Localization: Cytoplasm, cytoskeleton . Endosome . Cytoplasmic vesicle, secretory vesicle, acrosome . Cell junction, synapse, postsynaptic cell membrane, postsynaptic density . Cell projection, dendrite . Cell projection, dendritic spine . Cell junction, synapse . Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane. .
Gene ID: 23237
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Calculated MW: 45316
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. .
Other Names: Activity-regulated cytoskeleton-associated protein, ARC/ARG3.1, Activity-regulated gene 3.1 protein homolog, Arg3.1, ARC {ECO:0000312|EMBL:AAG33705.1}
Subcellular Localization: Cytoplasm, cytoskeleton . Endosome . Cytoplasmic vesicle, secretory vesicle, acrosome . Cell junction, synapse, postsynaptic cell membrane, postsynaptic density . Cell projection, dendrite . Cell projection, dendritic spine . Cell junction, synapse . Associated with the cell cortex of neuronal soma and dendrites. Enriched in postsynaptic density of dendritic spines. Associated with the sperm tail (By similarity). Enriched on the plasma membrane. .
Gene ID: 23237
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Calculated MW: 45316
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review