ATF6 Picoband polyclonal, anti-human, mouse, rat

ATF6 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10099
Catalog Number: AC-ABO10099
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Cyclic AMP-dependent transcription factor ATF-6 alpha(ATF6) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Cyclic AMP-dependent transcription factor ATF-6 alpha

Protein Function:
Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor. .

Other Names: Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, Activating transcription factor 6 alpha, ATF6-alpha, Processed cyclic AMP-dependent transcription factor ATF-6 alpha, ATF6

Subcellular Localization: Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Tissue Specificity: Ubiquitous.

Gene ID: 22926

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 74585

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ATF6 Picoband polyclonal, anti-human, mouse, rat