ATP2A1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Description:
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
fast twitch skeletal muscle isoform antibody, AT2A1_HUMAN antibody, ATP2A antibody, ATP2A1 antibody, ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody, ATPase Ca++ transporting fast twitch 1 antibody, ATPase, Ca(2+)-transporting fast twitch 1 antibody, Calcium pump 1 antibody, Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody, Calcium-transporting ATPase sarcoplasmic reticulum type antibody, Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody, Fast skeletal muscle SR calcium ATPase antibody, OTTHUMP00000162561 antibody, OTTHUMP00000162562 antibody, Sarcoendoplasmic reticulum calcium ATPase antibody, Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody, Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody, SERCA 1 antibody, SERCA1 antibody, SERCA1 truncated isoform, included antibody, SR Ca(2+) ATPase 1 antibody, SR Ca(2+)-ATPase 1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.