ATP2A2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

Description:
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
AT2A2_HUMAN antibody, ATP2A2 antibody, ATP2B antibody, ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody, Calcium pump 2 antibody, Calcium-transporting ATPase sarcoplasmic reticulum type antibody, Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody, Cardiac Ca2+ ATPase antibody, DAR antibody, DD antibody, Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody, MGC45367 antibody, Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody, SERCA 2 antibody, SERCA2 antibody, serca2a antibody, slow twitch skeletal muscle isoform antibody, SR Ca(2+)-ATPase 2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A2(1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A2(1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.