ATP2A3 polyclonal, anti-human, mouse, rat
€354.00
In stock
SKU
ARP-10-R1055
Quantity: 100 µg
Background:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.
Description:
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (ATP2A3) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
Adenosine triphosphatase calcium antibody, AT2A3_HUMAN antibody, ATP2A3 antibody, ATPase Ca(2+) transporting ubiquitous antibody, ATPase Ca++ transporting ubiquitous antibody, Calcium pump 3 antibody, Calcium translocating P type ATPase antibody, Sarco/endoplasmic reticulum Ca2+ ATPase antibody, Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 antibody, SERCA 3 antibody, SERCA3 antibody, SERCA3b antibody, SR Ca(2+) ATPase 3 antibody, SR Ca(2+)-ATPase 3 antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review