ATTY Picoband polyclonal, anti-human, mouse, rat

ATTY Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10096
Catalog Number: AC-ABO10096
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Tyrosine aminotransferase(TAT) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Tyrosine aminotransferase

Protein Function:
Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has much lower affinity and transaminase activity towards phenylalanine. .

Other Names: Tyrosine aminotransferase, TAT, 2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, TAT

Gene ID: 6898

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK), different from the related mouse and rat sequences by two amino acids.

Calculated MW: 50399

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ATTY Picoband polyclonal, anti-human, mouse, rat