ATX2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Description:
Rabbit IgG polyclonal antibody for Ataxin-2 (ATXN2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Ataxin 2 antibody, ATXN2 antibody, Olivopontocerebellar ataxia 2, autosomal dominant antibody, SCA2 antibody, Spinocerebellar ataxia type 2 protein antibody, TNRC13 antibody, Trinucleotide repeat containing gene 13 protein antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.