B3GNT8 Picoband polyclonal, anti-human

B3GNT8 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO12372
Catalog Number: AC-ABO12372
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human.Protein Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8

Protein Function:
Beta-1,3-N-acetylglucosaminyltransferase that plays a role in the elongation of specific branch structures of multiantennary N-glycans. Has strong activity towards tetraantennary N-glycans and 2,6 triantennary glycans. .

Other Names: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, BGnT-8, Beta-1,3-Gn-T8, Beta-1,3-N-acetylglucosaminyltransferase 8, Beta3Gn-T8, 2.4.1.-, B3GNT8 {ECO:0000312|EMBL:BAD86525.1}

Subcellular Localization: Golgi apparatus membrane ; Single-pass type II membrane protein .

Tissue Specificity: Highly expressed in small intestine, pancreas, spleen, bone marrow, lung, throat, and ileum, and weakly in fetal brain, cerebellum, heart, liver, tongue, breast, uteri, and testis. Not detected in colon. Differentially expressed in human tumor cell lines. .

Gene ID: 374907

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids.

Calculated MW: 43396

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:B3GNT8 Picoband polyclonal, anti-human