BCAR3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12532
Catalog Number: AC-ABO12532
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Breast cancer anti-estrogen resistance protein 3(BCAR3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Breast cancer anti-estrogen resistance protein 3
Protein Function:
May act as an adapter protein and couple activated growth factor receptors to a signaling pathway that regulates the proliferation in breast cancer cells. When overexpressed, it confers anti-estrogen resistance in breast cancer cell lines. May also be regulated by cellular adhesion to extracellular matrix proteins. .
Other Names: Breast cancer anti-estrogen resistance protein 3, Novel SH2-containing protein 2, SH2 domain-containing protein 3B, BCAR3, NSP2, SH2D3B
Tissue Specificity: Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. .
Gene ID: 8412
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
Calculated MW: 92566
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May act as an adapter protein and couple activated growth factor receptors to a signaling pathway that regulates the proliferation in breast cancer cells. When overexpressed, it confers anti-estrogen resistance in breast cancer cell lines. May also be regulated by cellular adhesion to extracellular matrix proteins. .
Other Names: Breast cancer anti-estrogen resistance protein 3, Novel SH2-containing protein 2, SH2 domain-containing protein 3B, BCAR3, NSP2, SH2D3B
Tissue Specificity: Ubiquitously expressed. Found in several cancer cell lines, but not in nonmalignant breast tissue. .
Gene ID: 8412
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
Calculated MW: 92566
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review