Bcl-X Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO12602
Catalog Number: AC-ABO12602
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Bcl-2-like protein 1(BCL2L1) detection. Tested with WB in Human.Protein Name: Bcl-2-like protein 1
Protein Function:
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage- dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.
Other Names: Bcl-2-like protein 1, Bcl2-L-1, Apoptosis regulator Bcl-X, BCL2L1, BCL2L, BCLX
Subcellular Localization: Isoform Bcl-X(L): Mitochondrion inner membrane . Mitochondrion outer membrane . Mitochondrion matrix . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane . Cytoplasm, cytosol . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus membrane ; Single-pass membrane protein ; Cytoplasmic side . After neuronal stimulation, translocates from cytosol to synaptic vesicle and mitochondrion membrane in a calmodulin-dependent manner (By similarity). Localizes to the centrosome when phosphorylated at Ser-49. .
Tissue Specificity: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
Gene ID: 598
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
Calculated MW: 26049
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage- dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.
Other Names: Bcl-2-like protein 1, Bcl2-L-1, Apoptosis regulator Bcl-X, BCL2L1, BCL2L, BCLX
Subcellular Localization: Isoform Bcl-X(L): Mitochondrion inner membrane . Mitochondrion outer membrane . Mitochondrion matrix . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane . Cytoplasm, cytosol . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus membrane ; Single-pass membrane protein ; Cytoplasmic side . After neuronal stimulation, translocates from cytosol to synaptic vesicle and mitochondrion membrane in a calmodulin-dependent manner (By similarity). Localizes to the centrosome when phosphorylated at Ser-49. .
Tissue Specificity: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
Gene ID: 598
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
Calculated MW: 26049
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review